PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy017324
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 568aa    MW: 61900.3 Da    PI: 7.9178
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59559006PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.28.3e-34277334260
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                dDgynWrKYGqK+vkgsefprsYY+Ct+ +Cpvkkkver+  d++++ei+Y+g+Hnhek
  Ahy017324 277 DDGYNWRKYGQKQVKGSEFPRSYYKCTHLNCPVKKKVERAP-DGHITEIIYKGQHNHEK 334
                8****************************************.***************85 PP

2WRKY107.19.1e-34454512159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++dpk+v++tYeg+Hnh+
  Ahy017324 454 LDDGYRWRKYGQKVVKGNPHPRSYYKCTSAGCNVRKHVERASSDPKAVITTYEGKHNHD 512
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.6E-29265336IPR003657WRKY domain
SuperFamilySSF1182902.48E-26274335IPR003657WRKY domain
SMARTSM007741.3E-37276334IPR003657WRKY domain
PROSITE profilePS5081123.571277335IPR003657WRKY domain
PfamPF031065.5E-26277333IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.3E-37439514IPR003657WRKY domain
SuperFamilySSF1182901.14E-29446514IPR003657WRKY domain
PROSITE profilePS5081139.226449514IPR003657WRKY domain
SMARTSM007744.8E-40454513IPR003657WRKY domain
PfamPF031061.9E-26455512IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
XKTYQIYQNQ FPNHFPFLTG EEKRERNTVK CPPPTPIQDA NSAAAPPQSS RPTITLPPRP  60
SAEAFFSGAG AGISPGPMTL VSSFFSDGGG SDSDYRSFSQ LLAGAMASPL AFGGASRPPF  120
PPPENPGENS GEEGAQKSLG FKQSRPMNLV VARSPMFTIP PGLSPSGFLN SPGFFSPQSP  180
FGMSHQQALA QVTAQAVFAQ SQMHMQADYQ APAVTAPTAP ANLSVEQPSF TQNEASQQQV  240
VPSVSEPSNA QVETSDISNT DNKKYQPSSM VIDKPADDGY NWRKYGQKQV KGSEFPRSYY  300
KCTHLNCPVK KKVERAPDGH ITEIIYKGQH NHEKPQANRR VKENNDSNGN SNVPPKSELT  360
SQGWVGNATK VAESMPDCSV PESDQTSNQG ASRLPGSSES EEVGNVDNRE EGDDGEPNPK  420
RRNTEVAVSE VPLSQKTVTE PKIIVQTRSE VDLLDDGYRW RKYGQKVVKG NPHPRSYYKC  480
TSAGCNVRKH VERASSDPKA VITTYEGKHN HDVPAARSSS HNTASNNSVP LKPHNPVPQK  540
HPLLKDMDFG SNDQRPVHLR LKEEQIIV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-40277515878Probable WRKY transcription factor 4
2lex_A6e-40277515878Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015962734.10.0PREDICTED: probable WRKY transcription factor 4
SwissprotQ9ZQ701e-154WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLA0A0S3RRX90.0A0A0S3RRX9_PHAAN; Uncharacterized protein
STRINGGLYMA18G49830.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-127WRKY DNA-binding protein 3